Skip to main content

Every lot tested to a published numeric specification · Certificates hosted by the testing laboratory

Cart

Research Library Articles · View in catalog →

Teduglutide

Also indexed as Gattex (United States), Revestive (European Union), ALX-0600, TAK-633, [Gly2]hGLP-2

1 Identity

Synthetic linear peptide, 33 residues, free acid C-terminus, no disulfide. At 33 residues it is regulated as a drug under an NDA, not as a biologic — it did not transition to a BLA in 2020 and should not be described as a biologic. Sold under euphemism as "GLP-2", "GLP2" and "GLP-2T" — the coded-naming pattern this catalog records against the GLP class generally, captured here as an alias so that a reader meeting the coded name elsewhere can resolve it to the actual peptide.

Sequence
H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH (HGDGSFSDEMNTILDNLAARDFINWLIQTKITD). The glycine at position 2 is the entire difference from native GLP-2, which carries alanine there.
Molecular formula
C164H252N44O55S
Average mass
3752.133 Da for C164H252N44O55S.
Monoisotopic mass
3749.79954 Da monoisotopic neutral; [M+H]+ 3750.80682.
Salt / variant note
Native human Glp-2 (1-33), C165H254N44O55S, 3766.16 Da, CAS 223460-79-5 — differs from this article by exactly one methylene group, 14.03 Da, or 0.37 percent of the mass. That is the whole identity question for this record. Also apraglutide, glepaglutide, elsiglutide, and GLP-2 (3-33). And the adjacent-listing problem: sellers file "GLP-2" beside "GLP-1" and "GLP-3", which in this market denote mono-, dual- and triple-agonist incretins and have nothing to do with the actual peptide GLP-2 — a naming collision that this catalog records against the incretin block and that lands squarely on this article.

2 Class & testing panel

Form
Single article
Testing panel
Special-class panelpanel definition

3 Primary sources & evidence

The index reports the design and provenance of the literature, not a conclusion about effect.

Regulatory evidence is complete and documentary. Structural evidence is authoritative: the sequence appears in the FDA label, and the formula is concordant across PubChem and two independent reagent catalogs, with both masses following from that formula.

4 Storage & specification

Storage
Not assigned. The article is not offered.
Shelf life
Not assigned. The article is not offered.

This record reports identity, specification and study design. It does not state what the article does in a human body. Supplied under the caution: “CAUTION: Contains a new drug for investigational use only in laboratory research animals or for tests in vitro. Not for use in humans.