Sermorelin + Ipamorelin

1 Identity

Fixed-ratio two-component article: a 29-residue C-terminally amidated native GHRH(1-29) fragment, all-L and containing one sulfur, co-lyophilized with a five-residue synthetic peptide of the GHRP class carrying three non-proteinogenic positions. The two components have no residue-level chemistry in common beyond phenylalanine and lysine, which is what makes an orthogonal compositional handle available here. Each component's full identity lives on its own record in the catalog and is cross-referenced from here rather than restated. Note that sermorelin and sermorelin acetate are the same molecule, differing in stated counterion and not two components.

Sequence

Per component, cross-referenced. Sermorelin YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, 29 residues, C-terminally amidated, one sulfur in Met27. Ipamorelin Aib-His-D-2-Nal-D-Phe-Lys-NH2, five residues, C-terminal primary amide.

Molecular formula

Per component; a mixture has no combined formula. Sermorelin C149H246N44O42S free base, supplied as the acetate and written C149H246N44O42S with x C2H4O2, the stoichiometry left as x because it is measured and not assumed. Ipamorelin C38H49N9O5 free base, mono-acetate C40H53N9O7. The single sulfur is the most useful compositional handle on this article: it belongs to sermorelin alone, ipamorelin has none, so total sulfur is a direct stoichiometric proxy for the sermorelin component and an orthogonal check on the measured ratio.

Average mass

Per component, on IUPAC 2021 abridged conventional atomic weights: sermorelin 3,357.933 Da free base; ipamorelin 711.868 Da. AT A nominal 5 mg + 5 mg fill, 10 mg total, the 1.0 : 1.0 mass ratio is a molar ratio of 1.00 : 4.72 — 1.48901 against 7.02377 micromol. Sermorelin against Modified GRF (1-29) is 10.021 Da, which is the separation this article's identity test must resolve.

Monoisotopic mass

Per component. Sermorelin 3,355.81870 neutral, [M+H]+ 3,356.82598, [M+3H]3+ 1,119.61351, [M+4H]4+ 839.96195, reported as a deconvoluted neutral. Ipamorelin 711.3857, [M+H]+ 712.3930. A plus or minus 5 ppm window on the sermorelin protonated ion is plus or minus 0.017 Da, comfortably inside the 10.021 Da separation from the tetrasubstituted analog but far too tight to be met by a nominal-mass instrument, whose output is not accepted for this component.

Salt / variant note

(1) the GRF fork, which is the substitution risk that matters: Modified GRF (1-29) at 3,367.954, 10.021 Da heavier and carrying no sulfur, sold widely as CJC-1295 no DAC; CJC-1295 (DAC:GRF) at 3,647.250; and (D-Ala2)-GRF(1-29) amide, the mono-substituted item found in a reagent catalog, a third distinct molecule. Sulfur presence or absence separates the first two from sermorelin without a mass spectrometer. (2) Methionine sulfoxide at +15.995 Da on the sermorelin component — a degradant with its own limit, not a variant. (3) the secretagogue fork: GHRP-2 817.992, GHRP-6 873.032, hexarelin 887.06. (4) Counterion per component, acetate being the institutional article for sermorelin. (5) Ratio: 5 mg + 5 mg is a stated nominal and no ratio is standard.

2 Class & testing panel

Form

Fixed-ratio blend

Testing panel

P1 and P3 — panel definitiontogether, as a union rather than the higher of the two, and every method runs on each component separately rather than once on the vial. P1 governs sermorelin, which is entirely proteinogenic and all-L; P3 governs ipamorelin, whose Aib1, D-2-Nal3 and D-Phe4 put three of five positions outside the proteinogenic set. The chiral method runs on the ipamorelin component against its own expected D-content and, on sermorelin, as a D-content limit rather than an expectation — any D-alanine at all in the sermorelin fraction indicates Modified GRF (1-29) contamination. A pooled chiral figure across the vial is meaningless and is not accepted

3 Primary sources & evidence

The index reports the design and provenance of the literature, not a conclusion about effect.

Published literature exists for each component, is graded on that component's record and is cross-referenced from here rather than restated. The sermorelin literature is old and narrow and attaches to the approved finished dosage forms rather than to bulk material, its principal approval-era study being Thorner and colleagues, PMID 8772599, with diagnostic-testing work from the late 1980s and 1990s around it. The ipamorelin literature is preclinical in substance and comes from a sponsor program that was discontinued. No published study of this fixed two-component combination at any ratio has been identified; that is a statement about the search rather than a finding about the combination. What governs acceptance of a blend lot is therefore the per-component evidence read alongside the measured ratio, not a citation for the combination.

4 Storage & specification

Storage

Co-lyophilized solid in amber Type I glass, bromobutyl stopper, nitrogen headspace, desiccant in the shipper; a non-sterile laboratory chemical with no sterility claim. Store at -20 degrees C plus or minus 5 degrees C, desiccated and protected from light. Two container-closure points travel from the component records and both apply: sermorelin adsorbs to glass and plastic at low concentration, so container-closure qualification includes a measured recovery check on the actual vial and stopper rather than an assumption carried from another product; and the ipamorelin naphthalene ring makes the solid photosensitive, so amber glass or foil overwrap is required. Vials are equilibrated to ambient temperature before opening. Shipped on dry ice.

Shelf life

Provisional at 24 months at -20 degrees C plus or minus 5 degrees C, desiccated and protected from light, from QA release, taken as the shorter of the two component intervals, both provisional 24 months, and reduced to a provisional 12 months where only 2-8 degrees C storage can be evidenced across the whole chain, which is the sermorelin component's own condition. The blend runs its own protocol and inherits no component study, with a mandatory 6-month interim pull on the first three lots. Trended attributes: per-component net content, the measured ratio, methionine sulfoxide, total deamidated species, C-terminal amide hydrolysis, water, counterion and any new peak above 0.10 percent.