Research Library › Blends · View in catalog →
Sermorelin + GHRP-6
Also indexed as Sermorelin + GHRP-6 and Sermorelin/GHRP-6, the market titles this composition carries
1 Identity
Fixed-ratio two-component article: a 29-residue C-terminally amidated native GHRH(1-29) fragment, all-L with one sulfur, co-lyophilized with a six-residue synthetic peptide of the GHRP class whose residues are all constitutionally proteinogenic though two are D-configured. That distinction is the analytical hinge of this article: the small component is separated from its cheaper relatives by stereochemistry rather than by any exotic residue. Each component's full identity lives on its own record in the catalog and is cross-referenced from here rather than restated.
- Sequence
- Per component, cross-referenced. Sermorelin YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, 29 residues, one sulfur in Met27. GHRP-6 H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2, six residues, two tryptophans. Both C-terminally amidated primary carboxamides.
- Molecular formula
- Per component; a mixture has no combined formula. Sermorelin C149H246N44O42S free base, supplied as the acetate with the stoichiometry measured rather than assumed. GHRP-6 C46H56N12O6 free base, C48H60N12O8 mono-acetate, C52H68N12O12 tri-acetate. The single sulfur belongs to sermorelin alone; GHRP-6 has none, so total sulfur is a stoichiometric proxy for the sermorelin component.
- Average mass
- Per component, on IUPAC 2021 abridged conventional atomic weights: sermorelin 3,357.933 Da; GHRP-6 873.032 Da. AT A nominal 5 mg + 5 mg fill, 10 mg total, the 1.0 : 1.0 mass ratio is a molar ratio of 1.00 : 3.85 — 1.48901 against 5.72717 micromol. Two separations govern acceptance: sermorelin against Modified GRF (1-29) at 10.021 Da, and GHRP-6 against hexarelin at 14.03 Da.
- Monoisotopic mass
- Per component. Sermorelin 3,355.81870 neutral, [M+H]+ 3,356.82598, [M+3H]3+ 1,119.61351, [M+4H]4+ 839.96195, reported as a deconvoluted neutral. GHRP-6 872.4446, [M+H]+ 873.4519, [M+2H]2+ 437.2296. Hexarelin at 886.4602 monoisotopic is +14.0157 from GHRP-6. Nominal-mass output is not accepted for either component, and the reasons differ: on sermorelin because a 10 Da separation on a multiply charged 3.4 kDa envelope needs accurate mass, on GHRP-6 because a 14 Da methyl substitution is invisible without it. Those are two different analytical problems and neither instruction substitutes for the other.
- Salt / variant note
- (1) the GRF fork: Modified GRF (1-29) at 3,367.954, 10.021 Da heavier with no sulfur; CJC-1295 (DAC:GRF) at 3,647.250; (D-Ala2)-GRF(1-29) amide, a third distinct molecule. Sulfur presence or absence separates them from sermorelin without a mass spectrometer. (2) Methionine sulfoxide at +15.995 Da, a degradant with its own limit. (3) hexarelin at 887.06, +14.03 from GHRP-6 and differing by one methyl on the residue-2 indole — the tightest substitution margin on this record. (4) GHRP-2 at 817.992, and [D-Lys3]-GHRP-6, which one institutional supplier lists and which is a different molecule. (5) Counterion per component; GHRP-6 as the tri-acetate is markedly hygroscopic. (6) Ratio: 5 mg + 5 mg is a stated nominal and no ratio is standard.
2 Class & testing panel
- Form
- Fixed-ratio blend
- Testing panel
- P1 and P3 — panel definitiontogether, as a union rather than the higher of the two, and every method runs on each component separately rather than once on the vial. P1 governs sermorelin. P3 governs GHRP-6 on stereochemistry alone — D-Trp2 and D-Phe5 — since it carries no non-proteinogenic residue, which makes the chiral method the load-bearing identity test for that component rather than a formality. On the sermorelin fraction the chiral result is a D-content limit, not an expectation
3 Primary sources & evidence
Published literature exists for each component, is graded on that component's record and is cross-referenced from here rather than restated. The sermorelin literature is old and narrow and attaches to the approved finished dosage forms rather than to bulk material, its principal approval-era study being Thorner and colleagues, PMID 8772599. The GHRP-6 literature is graded D, and D/C overall, and carries human pharmacology by identifier including PMID 7617137, PMID 10336729 and PMID 7581965. No published study of this fixed two-component combination at any ratio has been identified; that is a statement about the search rather than a finding about the combination. What governs acceptance of a blend lot is therefore the per-component evidence read alongside the measured ratio, not a citation for the combination.
4 Storage & specification
- Storage
- Co-lyophilized solid in amber Type I glass, bromobutyl stopper, nitrogen headspace, desiccant in the shipper; a non-sterile laboratory chemical with no sterility claim. Store at -20 degrees C plus or minus 5 degrees C, desiccated and protected from light. Amber glass or foil overwrap is mandatory rather than precautionary: GHRP-6 carries two indole side chains and is the most photolabile secretagogue in the catalog. Nitrogen headspace is written against the methionine and the two indoles rather than as housekeeping. Container-closure qualification includes a measured recovery check on the actual vial and stopper. Hygroscopic, markedly so where the GHRP-6 input is the tri-acetate; vials are equilibrated to ambient temperature before opening; shipped on dry ice.
- Shelf life
- Provisional at 24 months at -20 degrees C plus or minus 5 degrees C, desiccated and protected from light, from QA release, taken as the shorter of the two component intervals, both provisional 24 months, and reduced to a provisional 12 months where only 2-8 degrees C storage can be evidenced across the whole chain. The blend runs its own protocol and inherits no component study, with a mandatory 6-month interim pull on the first three lots. Trended attributes: per-component net content, the measured ratio, methionine sulfoxide, the sum of indole oxidation products, total deamidated species, C-terminal amide hydrolysis, water, counterion and any new peak above 0.10 percent.
This record reports identity, specification and study design. It does not state what the article does in a human body. Supplied under the caution: “CAUTION: Contains a new drug for investigational use only in laboratory research animals or for tests in vitro. Not for use in humans.”
