Research Library › Blends · View in catalog →
Sermorelin + GHRP-2 + GHRP-6 - Viking 1
Also indexed as Viking 1, Sermorelin + GHRP-2 + GHRP-6, the market titles this composition carries
1 Identity
Fixed-ratio three-component article: a 29-residue C-terminally amidated native GHRH(1-29) fragment, all-L with one sulfur, co-lyophilized with two six-residue peptides of the GHRP class. The two small components share their C-terminal four residues, Ala-Trp-D-Phe-Lys-NH2, which is the defining analytical feature of this article and governs how every method on it is built. GHRP-2 is also indexed as pralmorelin and is the active moiety of a medicine registered in Japan under the name GHRP Kaken 100. Each component's full identity lives on its own record in the catalog and is cross-referenced from here rather than restated. and Viking blend.
Contains Sermorelin + GHRP-2 + GHRP-6
- Sequence
- Per component, cross-referenced. Sermorelin YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, one sulfur in Met27. GHRP-2 H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2. GHRP-6 H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2. All three C-terminally amidated. The shared Ala-Trp-D-Phe-Lys-NH2 tail means the y1 to y4 ion series is common to GHRP-2 and GHRP-6, so MRM transitions for either must be built on N-terminal b-ions or on the intact precursor, never on the shared C-terminal series.
- Molecular formula
- Per component; a mixture has no combined formula. Sermorelin C149H246N44O42S free base, the acetate stoichiometry measured rather than assumed. GHRP-2 C45H55N9O6 free base, mono-TFA C47H56F3N9O8. GHRP-6 C46H56N12O6 free base, mono-acetate C48H60N12O8, tri-acetate C52H68N12O12. The single sulfur belongs to sermorelin alone and neither GHRP has any, so total sulfur is a stoichiometric proxy for the large component.
- Average mass
- Per component, on IUPAC 2021 abridged conventional atomic weights: sermorelin 3,357.933 Da; GHRP-2 817.992 Da; GHRP-6 873.032 Da. AT A nominal 5 mg + 5 mg + 5 mg fill, 15 mg total, the 1.0 : 1.0 : 1.0 mass ratio is a molar ratio of 1.00 : 4.11 : 3.85 — 1.48901, 6.11253 and 5.72717 micromol. The two small components are only 55.040 Da apart, the narrowest separation between two intentional constituents in this article, and that figure rather than the sermorelin separation is what sets the chromatographic requirement.
- Monoisotopic mass
- Per component. Sermorelin 3,355.81870 neutral, [M+H]+ 3,356.82598, [M+3H]3+ 1,119.61351, reported as a deconvoluted neutral. GHRP-2 817.4275, [M+H]+ 818.4348. GHRP-6 872.4446, [M+H]+ 873.4519. Two further separations are stated rather than assumed and must be resolved by the method: hexarelin at 886.4602 is +14.0157 from GHRP-6, and Modified GRF (1-29) is 10.021 Da from sermorelin on the average mass. Nominal-mass output is not accepted for any component of this article.
- Salt / variant note
- Six forks govern what is actually in the vial. (1) the GRF fork on the large component: Modified GRF (1-29) at 3,367.954 with no sulfur, CJC-1295 (DAC:GRF) at 3,647.250, and (D-Ala2)-GRF(1-29) amide. (2) hexarelin at 887.06, +14.03 from GHRP-6 by a single methyl. (3) the internal substitution risk, which is specific to this article: because both small components are present, a lot short of one and long of the other passes any total-peptide test and every identity test, and is caught only by the measured ratio. (4) Ipamorelin at 711.868 substituted for either GHRP. (5) Counterion per component. (6) Ratio: 5 mg + 5 mg + 5 mg is a stated nominal, and Viking 1 is a catalog title rather than a composition.
2 Class & testing panel
- Form
- Fixed-ratio blend
- Testing panel
- P1 and P3 — panel definitiontogether, as a union rather than the higher of the three, and every method runs on each component separately rather than once on the vial. P1 governs sermorelin. P3 governs GHRP-2 (D-Ala1, D-2-Nal2, D-Phe5, with 2-naphthylalanine non-proteinogenic) and GHRP-6 (D-Trp2, D-Phe5, no non-proteinogenic residue). The chiral method runs per component; a pooled figure is meaningless here because two of the three components contribute D-phenylalanine at one per mole and one also contributes D-alanine. Two ratios are acceptance criteria and not one: the sermorelin-to-GHRP ratio alone would pass a lot in which the two homologous small components had been swapped in part, so the GHRP-2 to GHRP-6 ratio is measured and specified beside it
3 Primary sources & evidence
Published literature exists for each component, is graded on that component's record and is cross-referenced from here rather than restated. The sermorelin literature is old and narrow and attaches to the approved finished dosage forms rather than to bulk material, its principal approval-era study being Thorner and colleagues, PMID 8772599. The GHRP-2 literature is graded B/C and carries human studies by identifier including PMID 17609397 and PMID 23079545. The GHRP-6 literature is graded D, and D/C overall, with human pharmacology by identifier including PMID 7617137, PMID 10336729 and PMID 7581965. No published study of this fixed three-component combination at any ratio has been identified, and nothing was found under the trade title either; that is a statement about the search rather than a finding about the combination. What governs acceptance of a blend lot is therefore the per-component evidence read alongside the two measured ratios, not a citation for the combination.
4 Storage & specification
- Storage
- Co-lyophilized solid in amber Type I glass, bromobutyl stopper, nitrogen headspace, desiccant in the shipper; a non-sterile laboratory chemical with no sterility claim. Store at -20 degrees C plus or minus 5 degrees C, desiccated and protected from light. This article carries a heavy photolability burden — three tryptophan indoles across two components plus a naphthalene ring — so amber glass or foil overwrap is mandatory rather than precautionary. Nitrogen headspace is written against those three indoles and the sermorelin methionine rather than as housekeeping. Container-closure qualification includes a measured recovery check on the actual vial and stopper. Hygroscopic; vials are equilibrated to ambient temperature before opening; shipped on dry ice.
- Shelf life
- Provisional at 24 months at -20 degrees C plus or minus 5 degrees C, desiccated and protected from light, from QA release, taken as the shortest of the three component intervals, each a provisional 24 months, and reduced to a provisional 12 months where only 2-8 degrees C storage can be evidenced across the whole chain. The blend runs its own protocol and inherits no component study, with a mandatory 6-month interim pull on the first three lots. Trended attributes: per-component net content, both measured ratios, methionine sulfoxide, the sum of indole oxidation products across three tryptophans, total deamidated species, C-terminal amide hydrolysis on all three, water, counterion and any new peak above 0.10 percent.
This record reports identity, specification and study design. It does not state what the article does in a human body. Supplied under the caution: “CAUTION: Contains a new drug for investigational use only in laboratory research animals or for tests in vitro. Not for use in humans.”
