KPV + Thymosin Alpha-1 + LL-37 - Triple Immune Blend

1 Identity

Fixed-ratio three-component article: three synthetic linear peptides, co-lyophilized. Not a molecule and not a single substance; a formulation. Chain lengths span 3 to 37 residues and masses span 342 Da to 4,493 Da, a 13-fold range within one vial. A four-component version sold under a different trade name adds BPC-157 and is a different article, so a supplier who writes 'immune blend' has not said which one was supplied.

Sequence

Per component. A, KPV: H-Lys-Pro-Val-OH, the free acid, three residues, all L, free lysine epsilon-amine. B, thymosin alpha-1: Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH, 28 residues, all L, N-alpha-acetylated at Ser1, free acid, no disulfide, no aromatic residue anywhere. C, LL-37: [LL-37, 37 aa], 37 residues, all L, free acid, no cysteine, methionine, tryptophan or tyrosine. LL-37 supplies the only aromatic residues in the article - four phenylalanines - the only arginines and the only glycines.

Molecular formula

Per component, never as a sum. KPV C16H30N4O4 (free acid); thymosin alpha-1 C129H215N33O55 (free base); LL-37 C205H340N60O53 (free acid). All three are normally supplied as acetate or trifluoroacetate salts, stated per component on the certificate. No combined formula is written: a mixture has no molecular formula and a certificate printing one describes something that does not exist. Total nominal fill is stated instead, and only alongside the per-component fills.

Average mass

Per component: KPV 342.440 Da; thymosin alpha-1 3,108.315; LL-37 4,493.342, each on IUPAC 2021 abridged conventional atomic weights. Worked example at 10 + 10 + 10 mg, 30 mg total nominal fill: 29.202, 3.217 and 2.226 micromol - a molar ratio of 13.12 : 1.45 : 1.00 out of a 1 : 1 : 1 mass ratio. Counterion is A first-order quantity on two of the three: LL-37's eleven basic residues make a fully trifluoroacetate-exchanged lot up to 21.8 percent counterion by weight; KPV has two protonatable sites and its bis-trifluoroacetate at 570.49 Da is 40.0 percent counterion, so a 10 mg gross fill of that salt contains about 6.0 mg of peptide.

Monoisotopic mass

Per component. KPV 342.22671 Da neutral, [M+H]+ 343.23399; thymosin alpha-1 3,106.50413, [M+H]+ 3,107.51140; LL-37 4,490.57543, reported as a deconvoluted neutral from a multiply-charged envelope with charge states printed, typically [M+4H]4+ near m/z 1,123.65. Identity is confirmed against all three neutrals in one run. Two near-collisions are named rather than left to be discovered: the KPV C-terminal amide at 341.24269 neutral is 0.98 Da lighter than the free acid, and Asn28 deamidation at plus 0.984 Da does not change chain length and is invisible below roughly 30,000 resolving power.

Salt / variant note

(1) KPV fork: free acid 342.44 against C-terminal amide 341.46, both shipped as 'alpha-MSH(11-13)' by different institutional houses at different prices, and KdPT (Lys-D-Pro-Thr) 344.41, a different sequence carrying a D-proline. The company specification is the free acid, named by residue and C-terminus on the purchase order. (2) thymosin alpha-1 fork: the des-acetyl species at 3,066.278 Da, exactly 42.037 Da lighter, is the specific failure mode of that synthesis. (3) LL-37 fork: C-terminal amide 4,492.36; FALL-39 4,711.60; KR-12 1,571.94; and a scrambled control of identical formula and mass, separable only chromatographically and by sequence-level MS/MS. (4) ratio: no standard presentation exists. (5) the name: 'immune blend' resolves to at least two compositions here.

2 Class & testing panel

Form

Fixed-ratio blend

Testing panel

P1 — panel definitionfor all three, run per component rather than once on the mixture. Each component is released against the full single-article P1 specification on the INPUT material before blending; the finished article is then released against the blend criteria. Any component offered as recombinant material moves the whole article to P4 - expression host declared, host-cell protein ELISA, residual host-cell DNA, SE-HPLC for aggregates

3 Primary sources & evidence

The index reports the design and provenance of the literature, not a conclusion about effect.

Each component carries its own published literature, and the three are described separately here. KPV is graded D, is entirely preclinical and analytical, and no human interventional literature was identified for it; the human ulcerative-colitis material circulating under the KPV name belongs to KdPT, a different molecule with a D-proline. Thymosin alpha-1 carries human randomized trials ETASS (PMID 23327199, n=361) and tests (PMID 39814420, n=1,106) plus a systematic review (PMID 33076834, 7 RCTs, 1,144 subjects) whose own stated limitations are that all trials were considered to have high risk of bias and all were from Chinese mainland. LL-37's file is large but lopsided: thousands of in-vitro reports against a small number of company-sponsored early-phase topical studies under the name ropocamptide, no Phase 3 dataset and no approval in any jurisdiction.

4 Storage & specification

Storage

The article is supplied as a white to off-white co-lyophilized solid in a screw-cap amber borosilicate vial with a PTFE-lined closure, with a desiccant sachet in the secondary pack - a laboratory-chemical presentation, non-sterile, no sterility claim, no stoppered-and-crimped injection format. Store at -20 degrees C plus or minus 5 degrees C, tightly closed, desiccated, light-protected, with -80 degrees C for holds beyond twelve months. Moisture control is the operative requirement, because water accelerates N-terminal diketopiperazine formation on the KPV component and that route is invisible inside an unspecified-impurity bucket. Low-adsorption or pre-passivated vessels are specified for dilute work, because LL-37 is strongly cationic and amphipathic and plates out onto ordinary borosilicate and polypropylene at low concentration. Reconstituted solution is aliquoted single-use at -80 degrees C.

Shelf life

Provisional 18 months at -20 degrees C plus or minus 5 degrees C, desiccated and light-protected, from QA release - taken as the shorter of the three component intervals, LL-37 at 18 months against 24 for KPV and thymosin alpha-1, short for the reason that record gives: a 37-mer has more available degradation routes and a thinner margin against a 95.0 percent purity limit. The blend runs its own protocol, with a mandatory 6-month interim pull on each of the first three lots assaying specifically for cyclo(Lys-Pro) and free valine rather than for total related substances. Attributes: per-component net content, every pairwise ratio, the des-acetyl species at minus 42.037 Da, deamidated and isomerized species reported individually rather than pooled, measured reconstitution recovery and turbidity, water, counterion per component.