IGF-1 (human, full length)

1 Identity

Single-chain polypeptide, 70 residues, three intramolecular disulfides, non-glycosylated. E. Coli-expressed. Not to be confused with mecasermin rinfabate (iPlex), a separate rhIGF-1/rhIGFBP-3 complex withdrawn from the US market.

Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (70 residues; UniProt P05019 residues 49-118, confirmed residue-for-residue against PDB 1GZR chain A). Disulfide connectivity in mature numbering: Cys6-Cys48, Cys18-Cys61, Cys47-Cys52.

Molecular formula

C331H512N94O101S7 (oxidized, three disulfides — the correct species for the folded protein).

Average mass

7648.714 Da average.

Monoisotopic mass

7643.58624 Da monoisotopic neutral; [M+H]+ 7644.59352.

Salt / variant note

IGF-1 LR3 is an 83-residue analogue carrying an Arg3 substitution and a 13-residue N-terminal extension, about 9,111 Da, and a different molecule. IGF-1 des, also recorded here, is des(1-3)IGF-1, the 67-residue truncation. This article is the 70-residue wild-type and is neither of them. Also IGF-2, insulin, proinsulin and INSL peptides, all sharing the insulin-superfamily disulfide architecture. Sellers routinely file all of these under "IGF-1".

2 Class & testing panel

Form

Single article

Testing panel

Special-class panel — panel definition

3 Primary sources & evidence

The index reports the design and provenance of the literature, not a conclusion about effect.

Sequence and connectivity are settled and agree across two independent primary sources, UniProt P05019 and PDB 1GZR. The formula and both masses follow from that sequence.

4 Storage & specification

Storage

Not assigned. The article is not offered.

Shelf life

Not assigned. The article is not offered.