Research Library › Blends · View in catalog →
AOD-9604 + MOTS-c + Tesamorelin
Also indexed as never adopted as identity statements
1 Identity
Fixed-ratio three-component article: two unmodified all-L peptide free acids, one of them disulfide-closed, co-lyophilized with one N-terminally acylated, C-terminally amidated 44-residue chain. No metal center, no non-proteinogenic residue, no conjugate. Each component's full identity lives on its own record in the catalog and is cross-referenced rather than restated. and "AOD / MOTS / Tesa" — market titles. This is the two-component Lean article with a third peptide added, and Lean has its own record. Two of the three names fix no molecule: "MOTS-c" covers five articles across the market, and no component name fixes a salt — tesamorelin is supplied as the acetate with undeclared stoichiometry, the other two as acetate or trifluoroacetate.
- Sequence
- Per component, cross-referenced. AOD-9604: H-YLRIVQCRSVEGSCGF-OH, 16 residues, one disulfide Cys7-Cys14. MOTS-c: H-MRWQEMGYIFYPRKLR-OH, 16 residues, free acid. Tesamorelin: [trans-3-hexenoyl]-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2, 44 residues, all L. One of the three termini is an amide and the other two are free acids, so a single C-terminal check reads one component and not the vial.
- Molecular formula
- Per component; a mixture has no combined formula and none is written. AOD-9604 C78H123N23O23S2. MOTS-c C101H152N28O22S2. Tesamorelin C221H366N72O67S free base; the supplied article is the acetate, written C221H366N72O67S with x C2H4O2, x approximately 7, which is how a salt of undeclared stoichiometry is properly written. Five sulfur atoms sit in this vial across three components — two cysteine thiols closed as one disulfide, two methionine thioethers and one more — so an elemental sulfur result separates nothing and is not accepted as a ratio method.
- Average mass
- Per component, on IUPAC 2021 abridged conventional atomic weights: AOD-9604 1,815.100; MOTS-c 2,174.621; tesamorelin 5,135.856 free base. Tesamorelin is the active moiety of an approved United States product — EGRIFTA, EGRIFTA SV and EGRIFTA WR, NDA 022505, originated by Theratechnologies Inc., approved 10 November 2010, with EGRIFTA WR approved 25 March 2025 — and the EGRIFTA WR prescribing information states 5,135.9 Da for the same entity. Worked example at a stated nominal 10 + 10 + 10 mg fill, 30 mg total: 5.509, 4.599 and 1.947 micromol, a 2.83 : 2.36 : 1.00 molar ratio out of a 1 : 1 : 1 mass ratio. A three-way equal-mass fill is a 2.8-fold molar spread, and the certificate states which basis the ratio criterion is written on. That fill is a stated nominal for arithmetic, not a market standard. No single blend molecular weight is printed; a mixture does not have one.
- Monoisotopic mass
- Per component, neutral: AOD-9604 1,813.8604; MOTS-c 2,173.1077; tesamorelin 5,132.7166. All three are observed multiply charged and each requires a deconvoluted spectrum alongside the raw charge envelope. At 5 kDa a plus or minus 5 ppm window is about plus or minus 0.026 Da and resolves nothing that matters on tesamorelin: it cannot see a single deamidation on a chain carrying five amide side chains, nor distinguish loss of the C-terminal amide from deamidation elsewhere.
- Salt / variant note
- (1) ratio: none standard; the single-article channel sells AOD-9604 at 5 mg, tesamorelin at 5, 10 and 20 mg and MOTS-c at 10, 20 and 40 mg, so an equal-mass three-way fill is a formulator's choice. (2) MOTS-c identity: five articles travel under one name, the K14Q polymorph sitting 0.036 Da from the parent. (3) tesamorelin salt: acetate with undeclared stoichiometry; at x approximately 7 the acetate contributes about 420 Da of gross weight, so a gross-weight fill overstates net peptide by roughly 8 percent on that component alone. (4) AOD-9604 redox state: disulfide-closed against reduced, 2.0157 Da.
2 Class & testing panel
- Form
- Fixed-ratio blend
- Testing panel
- P1 — panel definitionfor AOD-9604 and MOTS-c, P2 for tesamorelin, run per component and never once for the vial. The P2 element is not shared: acylation site occupancy, des-acyl content and integrity of the trans-3-hexenoyl cap belong to tesamorelin alone, and a des-acyl line reported for the vial has no meaning for two components that have nothing to lose. Marker selection is likewise derived from this three-component composition rather than carried over from the two-component article: methionine and lysine do not serve as per-component markers here, and the replacement markers are named on the certificate with their residue counts, which is what governs the conditioning of the calculation. The acetate arithmetic on tesamorelin sits on the face of the record for the same reason — an undeclared salt stoichiometry on one component of three is a ratio error that no per-component purity figure reveals
3 Primary sources & evidence
Published literature exists for each component, is graded on that component's record and is cross-referenced from here rather than restated. None of it is literature about this three-component mixture: no published study of this fixed combination has been identified, and no consensus specification for it exists. A blend lot is therefore accepted on per-component evidence read alongside a measured three-way ratio, not on a citation for the combination.
4 Storage & specification
- Storage
- Co-lyophilized solid at -20 degrees C plus or minus 5 degrees C, desiccated, protected from light, nitrogen headspace re-blanketed after subdivision. The labeled condition is the most restrictive of the three components rather than an average of them. The inert headspace is set by MOTS-c, the most oxidation-labile article in the vial, and reinforced by tesamorelin's own methionine and by AOD-9604's reducible disulfide sharing the same cake.
- Shelf life
- Dating runs on the blend's own stability protocol; the article inherits no component study. The question that protocol answers rather than assumes is whether tesamorelin's acetate load — roughly 420 Da per molecule at x approximately 7 — shifts the microenvironment pH of a co-lyophilized cake enough to move the deamidation trajectory of a chain carrying five amide side chains. The stability-indicating attributes are per-component content, the three-way ratio, des-acyl tesamorelin, deamidation, AOD-9604 free thiol, MOTS-c sulfoxide, water and counterion.
This record reports identity, specification and study design. It does not state what the article does in a human body. Supplied under the caution: “CAUTION: Contains a new drug for investigational use only in laboratory research animals or for tests in vitro. Not for use in humans.”
